Bizarre Fantasy is an enigmatic amalgamation of classic sci-fi and horror comics. This includes mysterious tales like: Who Toys With Terror, The Old Vampire Lady, The Phantom Of Philip Hawks, The Yeti, The Creature Within, The Thing In The Box, The Discombobulated Hand, and Pressed For Time. 100 Big Pages of Silver and Bronze Age comics of the otherworldly adventures!
Details
- Publication Date
- Apr 16, 2023
- Language
- English
- ISBN
- 9781312661912
- Category
- Comics & Graphic Novels
- Copyright
- No Known Copyright (Public Domain)
- Contributors
- By (author): Mini Komix
Specifications
- Pages
- 100
- Binding
- Paperback
- Interior Color
- Black & White
- Dimensions
- US Trade (6 x 9 in / 152 x 229 mm)
Keywords
comiccomicscomic bookcomic bookssilver agegolden agebronze agevampirevampireswitchwitchesfrankensteinyetisasquatchbigfootmad sciencetoytoyskiller dollkiller dollsdolldollshorrorhorror comicsmonstermonstersmonster comicsterrorrobotrobotsspaceouter spacespace comicssci-fiscience fictionfantasyzombiezombiesundeadwalking deadliving deadspace princessalienaliensscaresscaryspookycryptidcryptidsmonster toys