Monsterscope puts panorama to shame with some of the best from numerous monster mags, including Fantastic Monsters of the Films, Horror Monsters, and Mad Monsters! Featuring an interview with Bob Burns(Tracy of the ORIGINAL Ghostbusters!), looks at classic movie serials like Flash Gordon and Blackhawk, a Monsters' Travelogue to the Moon, make magic with the Mad Mummy, review robots in movie reels, attend the Black Zoo afterparty, and thumb through the very first Frankenstein comic! Mirthful monster madness from the Silver Age!
Details
- Publication Date
- Feb 11, 2023
- Language
- English
- ISBN
- 9781329793613
- Category
- Comics & Graphic Novels
- Copyright
- No Known Copyright (Public Domain)
- Contributors
- By (author): Mini Komix
Specifications
- Pages
- 76
- Binding Type
- Paperback Perfect Bound
- Interior Color
- Black & White
- Dimensions
- US Trade (6 x 9 in / 152 x 229 mm)
Keywords
horrorhorror comichorror comicsterrormonstermonstersmonster comicmonster comicsmonster moviesmonster movieschlockfanzinefanzineszinezinesflash gordonblackhawkspacespace comicsspace comicouter spacealienalienssci-fiscience-fictionmummymummiescommando codyrocketmanrocket manrobotrobotsvampirevampiresfrankensteinmarsmartianscartooncartoonskaijugiant monstergiant monsterswerewolfwerewolveswolfmanwolf manbob burnsking konggodzilladinosaurs