Honey clan, volume 6
This ebook may not meet accessibility standards and may not be fully compatible with assistive technologies.
Bees (Anthophila) are flying insects that feed on
flower nectar and pollen, an activity that results in pollination
flowers and, in some cases, with the production of honey and wax. The bees are the most important pollinating insects and the interdependence between them and plants make them an excellent example of a type of symbiosis known as "mutualism", an association between organisms different that is beneficial to both parties.
Bees are found on every continent except Antarctica, in every habitat on the planet that contains insect-pollinated flowering plants.
Bees feed on nectar and pollen, the former primarily as an energy source and the latter primarily for protein and other nutrients. Most pollen is used as food for their larvae.
To grow awareness of the importance of pollinators, of threats faced and their contribution to sustainable development, UN designated May 20 as World Bee Day.
Source: Wikipedia.
This book in digital format with 55 pages contains 51 photos of which 48 pictures are of bees during their working hours.
The photos were taken with a mobile phone and photo camera by Simon Ladislau (László), between the years 2022-2024, in Targu Mures municipality and Sangiorgiu de Mures commune all of which are located in Mures county, Romania.
Table of Contents are situated at page 53.
Targu Mures, January 2025
Simon Ladislau (László)
Web: latnivalo.lapunk.hu
Enjoy!
Details
- Publication Date
- May 27, 2026
- Language
- English
- Category
- Art & Photography
- Copyright
- All Rights Reserved - Standard Copyright License
- Contributors
- By (author): Simon Ladislau
Specifications
- Format
- EPUB
Keywords
artartistexhibitionalbume-bookcollectionbeesbeekeepernectarhoneysweetnutrientsnutritionhealthnaturalpollenlandscapefieldgreenyellowredbrownflowerplantsanimalswildlifeinsectsflyphotographersphotophotographyindividualvillagepictureimagepythonstuntcopyrightwordsyearclanteamenergyvitaminsmineralsproteinshakeboostbirds